AI & ChatGPT searches , social queriess for STOP CODON

Search references for STOP CODON. Phrases containing STOP CODON

See searches and references containing STOP CODON!

AI searches containing STOP CODON

STOP CODON

  • Stop codon
  • Codon that marks the end of a protein-coding sequence

    In molecular biology, a stop codon (or termination codon) is a codon (nucleotide triplet within messenger RNA) that signals the termination of the translation

    Stop codon

    Stop codon

    Stop_codon

  • Genetic code
  • Rules by which information encoded within genetic material is translated into proteins

    out of 64 codons in their experiments. Khorana, Holley and Nirenberg received the Nobel Prize (1968) for their work. The three stop codons were named

    Genetic code

    Genetic code

    Genetic_code

  • DNA and RNA codon tables
  • List of standard rules to translate DNA encoded information into proteins

    different codons in the genetic code and the below tables; most specify an amino acid. Three sequences, UAG, UGA, and UAA, known as stop codons, do not

    DNA and RNA codon tables

    DNA and RNA codon tables

    DNA_and_RNA_codon_tables

  • Nonsense mutation
  • Type of mutation in a DNA sequence

    point mutation in a sequence of DNA that results in a nonsense codon, or a premature stop codon in the transcribed mRNA, and leads to a truncated, incomplete

    Nonsense mutation

    Nonsense_mutation

  • Start codon
  • First codon of a messenger RNA translated by a ribosome

    The start codon is the first codon of a messenger RNA (mRNA) transcript translated by a ribosome. The start codon always codes for methionine in eukaryotes

    Start codon

    Start codon

    Start_codon

  • Open reading frame
  • DNA section marked with start and stop codon of different length

    reading frames are defined as spans of DNA sequence between the start and stop codons. Usually, this is considered within a studied region of a prokaryotic

    Open reading frame

    Open_reading_frame

  • Split gene theory
  • only permit short (< 600bp) open reading frames (ORFs) due to frequent stop codons. The short ORFs could have contained the short protein-coding exons observed

    Split gene theory

    Split_gene_theory

  • Codon usage bias
  • Genetic bias in coding DNA

    termination of translation (stop codons). There are 64 different codons (61 codons encoding for amino acids and 3 stop codons) but only 20 different translated

    Codon usage bias

    Codon usage bias

    Codon_usage_bias

  • Stop
  • Topics referred to by the same term

    skull Stop codon, a type of RNA molecule in genetic code STOP protein, a protein in animals Surgical termination of pregnancy, a type of abortion Stop consonant

    Stop

    Stop

  • Translation (biology)
  • Cellular process of protein synthesis

    depends on the release factor eRF1 that recognizes all three stop codons. When a stop codon is reached, termination of the polypeptide occurs the ribosome

    Translation (biology)

    Translation (biology)

    Translation_(biology)

  • Frameshift mutation
  • Mutation that shifts codon alignment

    reading of the codons after the mutation to code for different amino acids. The frameshift mutation will also alter the first stop codon ("UAA", "UGA"

    Frameshift mutation

    Frameshift mutation

    Frameshift_mutation

  • Proteinogenic amino acid
  • Amino acid that is incorporated biosynthetically into proteins during translation

    nearby UGA codon as selenocysteine (UGA is normally a stop codon). In some methanogenic prokaryotes, the UAG codon (normally a stop codon) can also be

    Proteinogenic amino acid

    Proteinogenic amino acid

    Proteinogenic_amino_acid

  • Amino acid
  • Organic compounds containing amine and carboxylic groups

    includes a SECIS element, which causes the UGA codon to encode selenocysteine instead of a stop codon. Pyrrolysine is used by some methanogenic archaea

    Amino acid

    Amino acid

    Amino_acid

  • Eukaryotic translation termination factor 1
  • Protein-coding gene in the species Homo sapiens

    the ERF1 gene. In Eukaryotes, eRF1 is an essential protein involved in stop codon recognition in translation, termination of translation, and nonsense mediated

    Eukaryotic translation termination factor 1

    Eukaryotic translation termination factor 1

    Eukaryotic_translation_termination_factor_1

  • Expanded genetic code
  • Modified genetic code

    number of 64 codons in the bacterial genome to 61 codons (eliminating two out of the six codons coding for serine and one out of three stop codons) – of which

    Expanded genetic code

    Expanded genetic code

    Expanded_genetic_code

  • Nonsense-mediated decay
  • Elimination of mRNA with premature stop codons in eukaryotes

    gene expression by eliminating mRNA transcripts that contain premature stop codons. Translation of these aberrant mRNAs could, in some cases, lead to deleterious

    Nonsense-mediated decay

    Nonsense-mediated decay

    Nonsense-mediated_decay

  • Stop-loss
  • Topics referred to by the same term

    variant that causes loss of a stop codon Stop-Loss (film), a 2008 film about soldiers subject to the stop-loss policy "Stop-Loss" (Dollhouse), an episode

    Stop-loss

    Stop-loss

  • Release factor
  • Protein family

    for the termination of translation by recognizing the termination codon or stop codon in an mRNA sequence. They are named so because they release new peptides

    Release factor

    Release_factor

  • Messenger RNA
  • RNA that is read by the ribosome to produce a protein

    are arranged into codons consisting of three ribonucleotides each. Each codon codes for a specific amino acid, except the stop codons, which terminate

    Messenger RNA

    Messenger RNA

    Messenger_RNA

  • MRNA surveillance
  • Intracellular mechanisms

    NMD are currently disputed. A premature stop codon must be recognized as different from a normal stop codon so that only the former triggers a NMD response

    MRNA surveillance

    MRNA_surveillance

  • Vertebrate mitochondrial code
  • Alternative genetic code

    all vertebrata. AGA and AGG were thought to have become mitochondrial stop codons early in vertebrate evolution. However, at least in humans it has now

    Vertebrate mitochondrial code

    Vertebrate_mitochondrial_code

  • Phage-assisted continuous evolution
  • Technique for the automated directed evolution of proteins

    addition of a TAG stop codon in the middle of gIII. Synthetases that aminoacylate the TAG codon's suppressor tRNA prevents stop codon activity, allowing

    Phage-assisted continuous evolution

    Phage-assisted_continuous_evolution

  • Mitochondrion
  • Organelle in eukaryotic cells responsible for respiration

    for tryptophan and not arginine; however, the codon in the processed RNA was discovered to be the UGG codon, consistent with the standard genetic code for

    Mitochondrion

    Mitochondrion

    Mitochondrion

  • Mold, protozoan, and coelenterate mitochondrial code and the mycoplasma/spiroplasma code
  • Genetic code in mitochondria of various organisms and in mycoplasma/spiroplasma

    with slight variations, notably the use of UGA as a tryptophan codon rather than a stop codon.    AAs = FFLLSSSSYY**CCWWLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG

    Mold, protozoan, and coelenterate mitochondrial code and the mycoplasma/spiroplasma code

    Mold,_protozoan,_and_coelenterate_mitochondrial_code_and_the_mycoplasma/spiroplasma_code

  • Cystic fibrosis
  • Genetic disorder affecting mostly the lungs

    ribosome to overcome the stop codon and produce a full-length CFTR protein. About 10% of CF results from a premature stop codon in the DNA, leading to early

    Cystic fibrosis

    Cystic fibrosis

    Cystic_fibrosis

  • Pyrrolysine
  • Chemical compound

    Pyrrolysine (symbol Pyl or O), encoded by the "amber" stop codon UAG, is a proteinogenic amino acid that is used in some methanogenic archaea and in bacteria

    Pyrrolysine

    Pyrrolysine

    Pyrrolysine

  • Codon reassignment
  • Typically codons, sets of three mRNA nucleotides, correspond to one specific amino acid. Codon reassignment is the exception to this rule. When a codon is reassigned

    Codon reassignment

    Codon_reassignment

  • Ribosome
  • Macromolecular machine that synthesizes proteins in cells

    termination, and ribosome recycling. The start codon in all mRNA molecules has the sequence AUG. The stop codon is one of UAA, UAG, or UGA; since there are

    Ribosome

    Ribosome

    Ribosome

  • Ambush hypothesis
  • Concept in molecular genetics regarding misreading of genes

    genetics that suggests that the prevalence of “hidden” or off-frame stop codons in DNA selectively deters off-frame translation of mRNA to save energy

    Ambush hypothesis

    Ambush hypothesis

    Ambush_hypothesis

  • Mutation
  • Alteration in the nucleotide sequence of a genome

    mutation in a sequence of DNA that results in a premature stop codon, or a nonsense codon in the transcribed mRNA, and possibly a truncated, and often

    Mutation

    Mutation

    Mutation

  • Glossary of cellular and molecular biology (M–Z)
  • sense/coding or antisense/template strand. sense codon Any codon that specifies an amino acid, as opposed to a stop codon, which does not specify any particular

    Glossary of cellular and molecular biology (M–Z)

    Glossary_of_cellular_and_molecular_biology_(M–Z)

  • Nonsense suppressor
  • nonsense codons placed in the coding sequence of a gene. Start codons can also be suppressed with suppressor initiator tRNAs, such as the amber stop codon suppressor

    Nonsense suppressor

    Nonsense_suppressor

  • Saturation mutagenesis
  • Technique used in protein engineering

    degenerate codons are used. 'NNK' and 'NNS' have the benefit of encoding all 20 amino acids, but still encode a stop codon 3% of the time. Alternative codons such

    Saturation mutagenesis

    Saturation mutagenesis

    Saturation_mutagenesis

  • Silent mutation
  • DNA mutation with no observable effect on an organism's phenotype

    amino acids involved in the swap correlate. The premature insertion of a stop codon, a nonsense mutation, can alter the primary structure of a protein. In

    Silent mutation

    Silent mutation

    Silent_mutation

  • Samoyed dog
  • Dog breed

    it is caused by a nonsense mutation in codon 1027 of the COL4A5 gene on the X chromosome (glycine to stop codon), which is similar to Alport's syndrome

    Samoyed dog

    Samoyed dog

    Samoyed_dog

  • Non-stop decay
  • Non-stop decay (NSD) is a cellular mechanism of mRNA surveillance to detect mRNA molecules lacking a stop codon and prevent these mRNAs from translation

    Non-stop decay

    Non-stop decay

    Non-stop_decay

  • Paramecium
  • Genus of unicellular ciliates, commonly studied as a representative of the ciliate group

    Paramecium, only UGA is decoded as a stop codon, while UAG and UAA are reassigned as sense codons (that is, codons that code for standard amino acids)

    Paramecium

    Paramecium

    Paramecium

  • CCR5-Δ32
  • Gene variant

    (homozygotes). CCR5 Δ32 is a 32-base-pair deletion that introduces a premature stop codon into the CCR5 receptor locus, resulting in a nonfunctional receptor. CCR5

    CCR5-Δ32

    CCR5-Δ32

  • Code
  • System of rules to convert information into another form or representation

    sequence of amino acids that form a protein molecule; a type of codon called a stop codon signals the end of the sequence. In mathematics, a Gödel code

    Code

    Code

  • Apolipoprotein B
  • Protein found in humans

    single mRNA transcript larger than 16 kb. ApoB48 is generated when a stop codon (UAA) at residue 2153 is created by RNA editing. There appears to be a

    Apolipoprotein B

    Apolipoprotein B

    Apolipoprotein_B

  • Transfer RNA
  • RNA that facilitates the addition of amino acids to a new protein

    tRNA specifies which three-nucleotide codon from the genetic code corresponds to which amino acid. Each mRNA codon is recognized by a particular type of

    Transfer RNA

    Transfer RNA

    Transfer_RNA

  • Mdx mouse
  • Popular model for studying Duchenne muscular dystrophy

    mutation in its DMD gene, changing the amino acid coding for a glutamine to STOP codon. This causes the muscle cells to produce a small, nonfunctional dystrophin

    Mdx mouse

    Mdx mouse

    Mdx_mouse

  • Lactate dehydrogenase
  • Class of enzymes

    mRNA, but the stop codon is interpreted as an amino acid-encoding codon. In consequence, translation continues to the next stop codon. This leads to

    Lactate dehydrogenase

    Lactate dehydrogenase

    Lactate_dehydrogenase

  • Ataluren
  • Duchenne muscular dystrophy medication

    premature stop codon mutation for Duchenne muscular dystrophy and rescues striated muscle function. Studies in mice with the premature stop codon mutation

    Ataluren

    Ataluren

    Ataluren

  • Cornish Rex
  • Breed of cat

    was identified to have a 4 base pair deletion. This induces a premature stop codon in the receptor that is absent in all straight haired cats analyzed. LPAR6

    Cornish Rex

    Cornish Rex

    Cornish_Rex

  • CRISPR gene editing
  • Gene editing method

    correct all three stop codons, but cannot create a stop codon. Therefore, the changes led >25% correction of the targeted stop codon with read through

    CRISPR gene editing

    CRISPR gene editing

    CRISPR_gene_editing

  • Titin
  • Largest known protein in human muscles

    splicing creates some transcripts that do not encounter the premature stop codon, ameliorating its effect. mRNA splicing factors such as RBM20 and SLM2

    Titin

    Titin

    Titin

  • Drosophila melanogaster
  • Species of fruit fly

    synthase, which is encoded on chromosome 3L. The gene has a premature stop codon in sepia flies, so that the flies cannot produce the pyrimidodiazepine

    Drosophila melanogaster

    Drosophila melanogaster

    Drosophila_melanogaster

  • Tag
  • Topics referred to by the same term

    shortened to TAG Tumor-associated glycoprotein, a type of protein TAG, a stop codon Tag (game), a playground game Tag (horse), an 18th-century thoroughbred

    Tag

    Tag

  • Trinucleotide repeat disorder
  • Genetic disorders due to increases in the number of repeating nucleotides

    located in introns or in a 3' untranslated region of code beyond the stop codon. The third category, largely producing toxic proteins with polyalanines

    Trinucleotide repeat disorder

    Trinucleotide_repeat_disorder

  • Transfer-messenger RNA
  • RNA family

    for example when reaching the end of a messenger RNA which has lost its stop codon. The tmRNA is remarkably versatile: it recycles the stalled ribosome,

    Transfer-messenger RNA

    Transfer-messenger RNA

    Transfer-messenger_RNA

  • Leptin
  • Hormone that inhibits hunger

    hyperphagia. A nonsense mutation in the leptin gene that results in a stop codon and lack of leptin production was first observed in mice. In the mouse

    Leptin

    Leptin

    Leptin

  • Point mutation
  • Replacement, insertion, or deletion of a single DNA or RNA nucleotide

    Nonsense mutations include stop-gain and start-loss. Stop-gain is a mutation that results in a premature termination codon (a stop was gained), which signals

    Point mutation

    Point mutation

    Point_mutation

  • Sup35p
  • nascent polypeptide chain when the ribosome encounters a stop codon. While eRF1 recognizes stop codons, eRF3 facilitates the release of the polypeptide chain

    Sup35p

    Sup35p

  • RNA editing
  • Molecular process

    create start and stop codons, but it cannot destroy existing start and stop codons. A cryptic start codon is created when the codon ACG is edited to be

    RNA editing

    RNA editing

    RNA_editing

  • Pseudogene
  • Functionless relative of a gene

    identification, the most commonly identified disablements are premature stop codons and frameshifts, which almost universally prevent the translation of

    Pseudogene

    Pseudogene

    Pseudogene

  • Hh blood group
  • Rare blood type

    Tyr316Ter mutation in the coding region of FUT1. The mutation introduces a stop codon, leading to a truncated enzyme that lacks 50 amino acids at the C-terminal

    Hh blood group

    Hh_blood_group

  • List of gaited horse breeds
  • neurological circuits related to limb movement and motion, causes a "premature 'stop codon'" in horses with lateral ambling gaits. Such breeds include the following:

    List of gaited horse breeds

    List_of_gaited_horse_breeds

  • De novo mutation
  • Genetic mutation not inherited from a parent

    or harmful. Nonsense mutation A nonsense mutation causes a premature stop codon in the nucleotide sequence, which leads to a discontinuation of protein

    De novo mutation

    De_novo_mutation

  • Kisspeptin
  • Mammalian protein

    polymorphic site represents the third position in a stop codon. When the adenosine is absent, a downstream stop codon is used, and the encoded protein extends for

    Kisspeptin

    Kisspeptin

    Kisspeptin

  • P-site
  • Ribosome binding site

    holds the tRNA which is linked to the growing polypeptide chain. When a stop codon is reached, the peptidyl-tRNA bond of the tRNA located in the P-site is

    P-site

    P-site

  • Consensus CDS Project
  • Dataset of protein-coding regions

    "Consensus" is defined as protein-coding regions that agree at the start codon, stop codon, and splice junctions, and for which the prediction meets quality

    Consensus CDS Project

    Consensus_CDS_Project

  • Pathophysiology
  • Convergence of pathology with physiology

    Colberg, J; Caro, JF (Jun 1995). "Evidence against either a premature stop codon or the absence of obese gene mRNA in human obesity". The Journal of Clinical

    Pathophysiology

    Pathophysiology

  • Genetic assimilation
  • Mechanism which genetically encodes phenotypes through evolutionary processes

    the existence of genetic assimilation in evolution; in yeast, when a stop codon is lost by mutation, the reading frame is preserved much more often than

    Genetic assimilation

    Genetic_assimilation

  • Bacterial translation
  • Protein synthesis process in bacteria

    translate the remaining codons on the mRNA as more aminoacyl-tRNA bind to the A site, until the ribosome reaches a stop codon on mRNA(UAA, UGA, or UAG)

    Bacterial translation

    Bacterial translation

    Bacterial_translation

  • Alternative splicing
  • Process by which a gene can code for multiple proteins

    intron must encode amino acids in frame with the neighboring exons, or a stop codon or a shift in the reading frame will cause the protein to be non-functional

    Alternative splicing

    Alternative splicing

    Alternative_splicing

  • Indian cobra
  • Species of snake

    from this genome. 85% of these predicted proteins contained start and stop codon, and 12% contained an N-terminal secretion signal sequence, which is an

    Indian cobra

    Indian cobra

    Indian_cobra

  • Biomolecule
  • Molecule produced by a living organism

    into some proteins at a UGA codon, which is normally a stop codon. Pyrrolysine is incorporated into some proteins at a UAG codon. For instance, in some methanogens

    Biomolecule

    Biomolecule

    Biomolecule

  • Nonstop
  • Topics referred to by the same term

    translation of mRNA molecules lacking a stop codon Non-stop flight, an airplane flight with no intermediate stops This disambiguation page lists articles

    Nonstop

    Nonstop

  • SECIS element
  • RNA sequence directing the translation of UGA codons as selenocysteines

    nucleotides) directs the cell to translate UGA codons as selenocysteines (UGA is normally a stop codon). SECIS elements are thus a fundamental aspect

    SECIS element

    SECIS element

    SECIS_element

  • APOBEC
  • Enzyme involved in messenger RNA editing

    resulting structure interacts with the codon CAA at codon 2153 and deaminates it into UAA, producing a stop codon that results in mRNA that is translated

    APOBEC

    APOBEC

    APOBEC

  • Insertion (genetics)
  • Type of mutation

    will cause the active translation of the gene to encounter a premature stop codon, resulting in an end to translation and the production of a truncated

    Insertion (genetics)

    Insertion (genetics)

    Insertion_(genetics)

  • PYLIS downstream sequence
  • Structure on some mRNA sequences

    This structural motif was previously thought to cause the UAG (amber) stop codon to be translated to the amino acid pyrrolysine instead of ending the protein

    PYLIS downstream sequence

    PYLIS downstream sequence

    PYLIS_downstream_sequence

  • Codon degeneracy
  • Redundancy of codons in the genetic code

    Degeneracy or redundancy of codons is the redundancy of the genetic code, exhibited as the multiplicity of three-base pair codon combinations that specify

    Codon degeneracy

    Codon_degeneracy

  • Protein biosynthesis
  • Assembly of proteins inside biological cells

    of the growing polypeptide chain occurs when the ribosome encounters a stop codon (UAA, UAG, or UGA) in the mRNA molecule. When this occurs, no tRNA can

    Protein biosynthesis

    Protein biosynthesis

    Protein_biosynthesis

  • Androgen insensitivity syndrome
  • Medical condition

    mutation can affect all downstream functional domains if a premature stop codon or framing error results; such a mutation can result in a completely unusable

    Androgen insensitivity syndrome

    Androgen insensitivity syndrome

    Androgen_insensitivity_syndrome

  • Tyrosinase
  • Enzyme for controlling the production of melanin

    mutation in nucleotide 1431 which converts a Tryptophan (TGG) into a stop codon (TGA), resulting in a shorter and inactive tyrosinase gene. Other albinos

    Tyrosinase

    Tyrosinase

    Tyrosinase

  • Baltimore classification
  • Virus classification system made by David Baltimore

    ORFs. Suppression of termination, also called stop codon read-through: certain viruses contain codons in their mRNA that would normally signal for termination

    Baltimore classification

    Baltimore classification

    Baltimore_classification

  • Termination signal
  • DNA or mRNA sequence representing the end of transcription or translation

    terminators. In the context of translation, a termination signal is the stop codon on the mRNA that elicits the release of the growing peptide from the ribosome

    Termination signal

    Termination signal

    Termination_signal

  • Wobble base pair
  • RNA base pair that does not follow Watson–Crick base pair rules

    codon) then a different tRNA is required for that anticodon. The minimum requirement to satisfy all possible codons (61 excluding three stop codons)

    Wobble base pair

    Wobble base pair

    Wobble_base_pair

  • Epigenetics
  • Study of DNA modifications that do not change its sequence

    PSI+ state and express dormant genetic features normally terminated by stop codon mutations. Prion-based epigenetics has also been observed in Saccharomyces

    Epigenetics

    Epigenetics

    Epigenetics

  • Central dogma of molecular biology
  • Explanation of the flow of genetic information within a biological system

    begins folding into the correct conformation. Translation ends with a stop codon which may be a UAA, UGA, or UAG triplet.[citation needed] The mRNA does

    Central dogma of molecular biology

    Central_dogma_of_molecular_biology

  • Alloprotein
  • redundancy of the 3 codons that encode a "stop" signal. If one of these can be substituted by another stop codon, then that codon can in principle be

    Alloprotein

    Alloprotein

  • Labrador Retriever coat colour genetics
  • Genetics behind Labrador Retriever coat colour

    R.; Rothuizen, J.; van Oost, B (2000). "Identification of a premature stop codon in the melanocyte-stimulating hormone receptor gene (MC1R) in Labrador

    Labrador Retriever coat colour genetics

    Labrador Retriever coat colour genetics

    Labrador_Retriever_coat_colour_genetics

  • APOBEC1
  • Protein-coding gene in the species Homo sapiens

    inhibition of viral replication. Its function relies on introducing a stop codon into apolipoprotein B (ApoB) mRNA, which alters lipid metabolism in the

    APOBEC1

    APOBEC1

    APOBEC1

  • Aromatase deficiency
  • Medical condition

    Resulting in a stop codon after 21 codons 0.0 Male C to A substitution in intron V, at 3' splicing acceptor site before exon VI Premature stop codon - Male Insertion

    Aromatase deficiency

    Aromatase deficiency

    Aromatase_deficiency

  • Penicillium roqueforti
  • Species of fungus

    in ORF 11 of the PR toxin biosynthetic cluster introduces a premature stop codon; a deletion in the lipase/esterase domain of the mpaC gene prevents MPA

    Penicillium roqueforti

    Penicillium roqueforti

    Penicillium_roqueforti

  • Golden Gate Cloning
  • Molecular cloning method for DNA assembly

    an eight-nucleotide scar sequence, which codes for a tyrosine and a stop codon, is left between every segment added into the plasmid. Golden Gate assembly

    Golden Gate Cloning

    Golden Gate Cloning

    Golden_Gate_Cloning

  • Filariasis
  • Parasitic disease caused by a family of nematode worms

    had an extra 29 amino acid long extension. The WbSXP-1 variant, where a stop codon has been introduced at the amino acid position 153 has been shown to be

    Filariasis

    Filariasis

    Filariasis

  • Nonsynonymous substitution
  • Nucleotide mutation that alters the amino acid sequence

    a stop codon. Another type of mutation that deals with stop codons is known as a nonstop mutation or readthrough mutation, which occurs when a stop codon

    Nonsynonymous substitution

    Nonsynonymous_substitution

  • Prime editing-mediated readthrough of premature termination codons
  • Genome editing strategy

    readthrough of premature stop codons. The mechanism targets the general molecular mechanism of ribosomal recognition of premature stop codons and is therefore

    Prime editing-mediated readthrough of premature termination codons

    Prime_editing-mediated_readthrough_of_premature_termination_codons

  • Standardbred
  • American breed of horse

    The point mutation causes early termination of the gene by coding for a stop codon, thus altering the function of this transcription factor. Uniquely, both

    Standardbred

    Standardbred

    Standardbred

  • Untranslated region
  • Non-coding regions on either end of mRNA

    eukaryotes. The 3' UTR is found immediately following the translation stop codon. The 3' UTR plays a critical role in translation termination as well as

    Untranslated region

    Untranslated region

    Untranslated_region

  • Tobacco mosaic virus
  • Virus affecting plants of the Solanaceae family

    produce a single protein due to ribosomal readthrough of a leaky UAG stop codon. The four genes encode a replicase (with methyltransferase [MT] and RNA

    Tobacco mosaic virus

    Tobacco mosaic virus

    Tobacco_mosaic_virus

  • Polyadenylation
  • Addition of adenylic acids to 3' end of mature mRNA

    nucleotides long on average. The stabilising ones start at the stop codon, and without them the stop codon (UAA) is not complete as the genome only encodes the

    Polyadenylation

    Polyadenylation

  • Chargaff's rules
  • Two rules about the percentage of A, C, G, and T in DNA strands

    encoded by the stop codons—TGA and TAG respectively.) The mismatch between the number of codons and amino acids allows several codons to code for a single

    Chargaff's rules

    Chargaff's rules

    Chargaff's_rules

  • Bacteriophage Qbeta
  • Species of virus

    maturation/lysis protein A2; the coat protein; a readthrough of a leaky stop codon in the coat protein, called A1; and the β-subunit of an RNA-dependent

    Bacteriophage Qbeta

    Bacteriophage Qbeta

    Bacteriophage_Qbeta

  • Familial adenomatous polyposis
  • Pre-cancerous intestinal polyps

    "ApcMin" mouse model was described in 1990 and carries an Apc allele with a stop codon at position 850. Heterozygosity for this mutation results in a fully penetrant

    Familial adenomatous polyposis

    Familial adenomatous polyposis

    Familial_adenomatous_polyposis

  • Gag/pol translational readthrough site
  • readthrough site facilitates the mechanism of translation readthrough of the stop codon at the gag-pol junction producing the gag and pol fusion protein in certain

    Gag/pol translational readthrough site

    Gag/pol translational readthrough site

    Gag/pol_translational_readthrough_site

  • Horse gait
  • Ways of movement of equines

    DMRT3, which is related to limb movement and motion, causes a premature "stop codon" in horses with lateral ambling gaits. The major ambling gaits include:

    Horse gait

    Horse gait

    Horse_gait

AI & ChatGPT searchs for online references containing STOP CODON

STOP CODON

AI search references containing STOP CODON

STOP CODON

AI search queriess for Facebook and twitter posts, hashtags with STOP CODON

STOP CODON

Follow users with usernames @STOP CODON or posting hashtags containing #STOP CODON

STOP CODON

Online names & meanings

  • Eshek
  • Girl/Female

    Biblical

    Eshek

    Violence.

  • Ayana
  • Girl/Female

    Indian

    Ayana

    Pretty flower

  • Yaadhavi | யாதாவீ
  • Girl/Female

    Tamil

    Yaadhavi | யாதாவீ

    Goddess Durga

  • Palin
  • Surname or Lastname

    Welsh

    Palin

    Welsh : Anglicized form of the Welsh patronymic ap Heilyn ‘son of Heilyn’, which is probably a derivative of a word meaning ‘to serve at table’.English : habitational name from Palling in Norfolk or Poling in Sussex. These were named in Old English with the personal names Pælli and Pāl respectively, + -ingas ‘followers of’, ‘dependants of’.French : unexplained.A Palin, also written Palen and Pallin, from the Poitou region of France, is documented in Quebec City in 1692, with the secondary surname Dabonville.

  • Rahi
  • Boy/Male

    Hindu

    Rahi

    Traveler

  • Aarshvi | ஆர்ஷ்வீ
  • Girl/Female

    Tamil

    Aarshvi | ஆர்ஷ்வீ

  • Vrajakishore | வ்ரஜகிஷோரே 
  • Boy/Male

    Tamil

    Vrajakishore | வ்ரஜகிஷோரே 

    Lord Krishna

  • Samoon |
  • Boy/Male

    Muslim

    Samoon |

  • Vakti
  • Girl/Female

    Hindu

    Vakti

    Speech

  • Jagati | ஜகதீ
  • Girl/Female

    Tamil

    Jagati | ஜகதீ

    The earth, Of the universe, Bestowed with speed

AI search & ChatGPT queriess for Facebook and twitter users, user names, hashtags with STOP CODON

STOP CODON

Top AI & ChatGPT search, Social media, medium, facebook & news articles containing STOP CODON

STOP CODON

AI searchs for Acronyms & meanings containing STOP CODON

STOP CODON

AI searches, Indeed job searches and job offers containing STOP CODON

Other words and meanings similar to

STOP CODON

AI search in online dictionary sources & meanings containing STOP CODON

STOP CODON

  • Shop
  • n.

    A building in which mechanics or artisans work; as, a shoe shop; a car shop.

  • Strop
  • v. t.

    To draw over, or rub upon, a strop with a view to sharpen; as, to strop a razor.

  • Stop
  • n.

    Some part of the articulating organs, as the lips, or the tongue and palate, closed (a) so as to cut off the passage of breath or voice through the mouth and the nose (distinguished as a lip-stop, or a front-stop, etc., as in p, t, d, etc.), or (b) so as to obstruct, but not entirely cut off, the passage, as in l, n, etc.; also, any of the consonants so formed.

  • Step
  • v. t.

    To fix the foot of (a mast) in its step; to erect.

  • Stop
  • v. t.

    To obstruct; to render impassable; as, to stop a way, road, or passage.

  • Atop
  • adv.

    On or at the top.

  • Long-stop
  • n.

    One who is set to stop balls which pass the wicket keeper.

  • Top
  • v. t.

    To rise to the top of; to go over the top of.

  • Stop-over
  • a.

    Permitting one to stop over; as, a stop-over check or ticket. See To stop over, under Stop, v. i.

  • Step
  • v. i.

    The space passed over by one movement of the foot in walking or running; as, one step is generally about three feet, but may be more or less. Used also figuratively of any kind of progress; as, he improved step by step, or by steps.

  • Stop
  • v. t.

    To hinder from acting or moving; to prevent the effect or efficiency of; to cause to cease; to repress; to restrain; to suppress; to interrupt; to suspend; as, to stop the execution of a decree, the progress of vice, the approaches of old age or infirmity.

  • Stop
  • n.

    That which stops, impedes, or obstructs; as obstacle; an impediment; an obstruction.

  • Stoop
  • v. t.

    To bend forward and downward; to bow down; as, to stoop the body.

  • Stop
  • n.

    In the organ, one of the knobs or handles at each side of the organist, by which he can draw on or shut off any register or row of pipes; the register itself; as, the vox humana stop.

  • Stop
  • v. t.

    To arrest the progress of; to hinder; to impede; to shut in; as, to stop a traveler; to stop the course of a stream, or a flow of blood.

  • Stop
  • v. i.

    To spend a short time; to reside temporarily; to stay; to tarry; as, to stop with a friend.

  • Stop
  • v. i.

    To cease to go on; to halt, or stand still; to come to a stop.

  • Stop
  • v. t.

    To close, as an aperture, by filling or by obstructing; as, to stop the ears; hence, to stanch, as a wound.

  • Step
  • v. i.

    A small space or distance; as, it is but a step.

  • Top
  • n.

    Top-boots.