AI & ChatGPT searches , social queriess for LL 89
Search references for LL 89. Phrases containing LL 89
See searches and references containing LL 89!
Search references for LL 89. Phrases containing LL 89
See searches and references containing LL 89!LL 89
Elite Finnish ringette and ice hockey club
Lapinlahden Luistin -89 (abbr. LL-89) in Lapinlahden, from the municipality Pohjois-Savosta, is a home club specializing in ice sports, whose sports include
LL_-89
Finland's elite semi-professional ringette league
spectators.[citation needed] Lapinlahden Luistin −89 Ry, (Lapinlahden Luistin -89), commonly referred to as "LL-89", is a ringette team that competes in Finland's
SM_Ringette
Type of divination
Barten Holyday's Technogamia, or the Marriage of the Arts (1618: II. iii. ll. 89-146 (G2v)). Richard Godbeer, The Devil's Dominion: Magic and Religion in
Coscinomancy
1837 poem by Alexander Pushkin
destroyed (ll. 57–60), and falls into a crazed delirium and breaks into laughter (ll. 61–65). For a year, he roams the street as a madman (ll. 89–130), but
The_Bronze_Horseman_(poem)
This is the discography of American rapper LL Cool J. Action Bronson - "Strictly 4 My Jeeps (remix)" (w/ Lloyd Banks) (Album: n/a) Alicia Keys - "Teenage
LL_Cool_J_discography
Italian law enforcement agency
Crestitalia plans Tognacci class: MM.LL.84 MM.LL.85 MM.LL.86 MM.LL.87 MM.LL.88 MM.LL.89 MM.LL.90 MM.LL.91 MM.LL.92 MM.LL.93 second half years '60 '80 Cantiere
Guardia_di_Finanza
Elite Finnish ringette player
Urheilun vuosikirja 41. Urheilumuseo. pp. 176–177. ISBN 978-952-6644-16-5. "LL-89 defeat the defending champion Cambridge Turbos to move on to an all Finnish
Anne_Pohjola
Finnish ice hockey league
tournament. Ilves Ak PaRa Pelicans TPS Ak / Turku HC JyKi KeuPa Kiilat LL-89 MuJK S-Kiekko HIFK Ch K-Espoo Ch Salo HT Lohko 1 HIFK Challenger, Helsinki
Naisten_Suomi-sarja
the semi-final, LL -89 overcame the Cambridge Turbos, 3–1. The Championship Finale consisted entirely of Finnish clubs where team LL -89 went up against
Ringette World Club Championship
Ringette_World_Club_Championship
American singer (1958–2009)
Morris, Chris (June 27, 2018). "Joe Jackson, Jackson Family Patriarch, Dies at 89". Variety. Archived from the original on November 8, 2022. Retrieved April
Michael_Jackson
Type of lease in Hong Kong
Road 2856 I.L. 2300 IL 2300: 999 years from 1 September 1857 Shelley Street LL Tower 2-4 Shelly Street 2843 I.L. 116 I.L. 116: 75 years extended to 999 years
999-year_leases_in_Hong_Kong
Twenty-fifth letter of the Latin alphabet
ISO basic Latin alphabet AaBbCcDdEeFfGgHhIiJjKkLlMmNnOoPpQqRrSsTtUuVvWwXxYyZz v t e
Y
Group of antimicrobial peptides in vertebrates
antimicrobial peptide encoded in the human by the CAMP gene. The active form is LL-37, a 37 amino acid peptide having sequence [LL-37, 37 aa]
Cathelicidin antimicrobial peptide
Cathelicidin_antimicrobial_peptide
Record label founded by Emil E. Shalit in the 1940s
"Only Six Feet" [SJ3819] 1608 Yesufu Adeyemo & His Fabulous Group "Omo Laso ll" / "Owo Mi Re" SJ3821 / SJ3823 1609 The Bulgarian Variety Orchestra, conducted
Melodisc_Records
Finnish second-tier ice hockey league
2014: Rovaniemen Kiekko (RoKi), Rovaniemi 2015: Lapinlahden Luistin -89 Red Lights (LL-89), Lapinlahti Auroraliiga Women's ice hockey in Finland Content in
Naisten_Mestis
1939–1945 global conflict
same time, China had roughly six times the population of Japan but only an 89 percent higher GDP; this reduces to three times the population and only a
World_War_II
raid Ctesiphon and gains territory on the Peace of Nisibis (299). Shapur ll's Arab Campaign (325) Sasanian Empire Arabs Iyad Taghlib Banu Bakr Banu Abdul
List of wars involving Iran (before 1979)
List_of_wars_involving_Iran_(before_1979)
American television series (2024–present)
Retrieved April 16, 2025. Pucci, Douglas (April 23, 2025). "Monday Ratings: LL Cool J Guest Spot Boosts 'NCIS 'on CBS to its Most-Watched Telecast Since
NCIS:_Origins
Tennis championship
replaced by Petra Martić (LL) § Markéta Vondroušová (39) → replaced by Harriet Dart (LL) § Anna Kalinskaya (14) → replaced by Eva Lys (LL) ‡ – withdrew from
2025 Australian Open – Women's singles
2025_Australian_Open_–_Women's_singles
Tennis championship
(89) → replaced by Erika Andreeva (100) ‡ Julia Grabher (73 PR) → replaced by Renata Zarazúa (101) @ Jodie Burrage (98) → replaced by Jana Fett (LL) @
2024 French Open – Women's singles
2024_French_Open_–_Women's_singles
Network that allows computers to share resources and communicate with each other
Implementation and Specification. IETF. doi:10.17487/RFC1035. RFC 1035. Peterson, L.L.; Davie, B.S. (2011). Computer Networks: A Systems Approach (5th ed.). Elsevier
Computer_network
Pandemic caused by SARS-CoV-2
other countries". Science. doi:10.1126/science.abb5426. S2CID 216508232. Pike LL (25 November 2020). "In China, nearly 1 million people have reportedly already
COVID-19_pandemic
Season of television series
U.S. Navy Vice Admiral and Parker's sister Adam Campbell as Young Ducky LL Cool J as Sam Hanna, NCIS Senior Field Agent Seamus Dever as Gabriel Laroche
NCIS_season_23
Canada, District 206, Subdistrict f-93 (Cariboo Crossing, Yukon), at page 2, ll. 26-27. Charlie told the census that 1864 or 1865 would have been his year
List of White Pass and Yukon Route locomotives and cars
List_of_White_Pass_and_Yukon_Route_locomotives_and_cars
to Turn Crowd On". The Buffalo News. November 24, 1969. pp. 28 - Section ll. D.c, Signed (2010-06-23). "1969 Ads: The Electric Circus". It's All The Streets
List of Ike & Tina Turner live performances
List_of_Ike_&_Tina_Turner_live_performances
Chronic disease caused by bacterial infection
organization, and restrict bacillary multiplication; at the lepromatous pole (BL/LL), there is Th2/regulatory bias (e.g., IL-4, IL-10), weaker cell-mediated immunity
Leprosy
American rapper and actor (born 1958)
intended as a diss to LL Cool J, by making a crude song to contrast with the love songs that LL was making at the time. On LL's response, "To da Break
Ice-T
American singer-songwriter (born 1941)
"Dance" and "Dreams". Dylan's records ranged from Muddy Waters to Prince, L.L. Cool J to the Streets. Dylan's show was praised for the breadth of his musical
Bob_Dylan
S.A.F.; Mocke, H.; Gibson, B.M.; Tingle, K.; Schiffbauer, J.D.; Nelson, L.L.; Laflamme, M. (2025-08-25). "JOGS Lagerstätten: Ediacaran soft-bodied fossils
List_of_lagerstätten
Binary star in the constellation Aquarius
LL Aquarii is an eclipsing binary star system in the equatorial constellation of Aquarius, abbreviated LL Aqr. At peak brightness it has a combined apparent
LL_Aquarii
Letter Y with tilde Medievalist U+1EFA Ỻ Latin Capital Letter Middle-Welsh LL U+1EFB ỻ Latin Small Letter Middle-Welsh LL U+1EFC Ỽ Latin Capital Letter Middle-Welsh
List_of_Unicode_characters
Element of Japanese language
Hie to your chamber: I 'll find Romeo To comfort you: I wot well where he is. Hark ye, your Romeo will be here at night: I 'll to him; he is hid at Lawrence'
Japanese conjugation (ren'yōkei base)
Japanese_conjugation_(ren'yōkei_base)
Queen of the United Kingdom from 1952 to 2022
88–89; Shawcross 2002, p. 178 Elizabeth to her staff, quoted in Shawcross 2002, p. 178 Pimlott 2001, pp. 336–337, 470–471; Roberts 2000, pp. 88–89 Heinricks
Elizabeth_II
American actor and producer (born 1972)
In August 2021, a comic book adaptation of the original concept, Batman '89, began publication, by DC Entertainment, using Wayans's likeness for Robin
Marlon_Wayans
American rapper (born 1962)
York rapper LL Cool J. Along with other rappers such as MC Shan, Kool Moe Dee claimed that LL had stolen their rap styles. He also felt that LL was disrespecting
Kool_Moe_Dee
Small domesticated carnivorous mammal
tb02496.x. ISSN 0022-4510. PMID 11570385. Fettman, M.J; Stanton, C.A; Banks, L.L; Hamar, D.W; Johnson, D.E; Hegstad, R.L; Johnston, S (1997). "Effects of
Cat
class of 1961 (LL.B), District of Idaho (1989–2015), senior judge (2015–19), bankruptcy judge (1988–89) Ray McNichols, class of 1950 (LL.B), District of
List of University of Idaho College of Law alumni
List_of_University_of_Idaho_College_of_Law_alumni
2026. Cordero, Rosy (April 15, 2026). "'NCIS' Gets New York Spinoff Series: LL Cool J Returns As Agent Sam Hanna, Scott Caan Also Stars". Deadline Hollywood
2026_in_American_television
American rapper and dancer (born 1962)
in nightclubs. Hammer declared he was "second to none from Doug E. Fresh, LL Cool J or DJ Run" within the song. He would continue to call out other East
MC_Hammer
American politician and naval officer (1936–2018)
degrees, including from Colgate University (LL.D; 2000), The Citadel (DPA; 2002), Wake Forest University (LL.D; May 20, 2002), the University of Southern
John_McCain
September 16, 1988 Cerro Tololo S. J. Bus · 5.2 km MPC · JPL 35067 1989 LL — June 4, 1989 Palomar E. F. Helin · 3.4 km MPC · JPL 35068 1989 SF4 — September
List of minor planets: 35001–36000
List_of_minor_planets:_35001–36000
Tennis championship
round) 33. Elise Mertens (fourth round) Key Q = Qualifier WC = Wild card LL = Lucky loser Alt = Alternate ITF = ITF entry PR = Protected ranking SR =
2024 US Open – Women's singles
2024_US_Open_–_Women's_singles
1346–1353 pandemic in Eurasia and North Africa
1017/S0025727300072100. PMC 2630035. PMID 18575083. Christakos G, Olea RA, Serre ML, Wang LL, Yu HL (2005). Interdisciplinary Public Health Reasoning and Epidemic Modelling:
Black_Death
Rank Manager LL CdR SdE CED CdlL UCL UEL USC LC IC CI FCWC FIC Total 1 Carlo Ancelotti 2 2 2 – – 3 – 3 – – – 2 1 15 2 Miguel Muñoz 9 2 – – – 2 – – – 1
List of Real Madrid CF managers
List_of_Real_Madrid_CF_managers
List of songs about the U.S. state Oklahoma
singer-songwriters, "Oklahoma Blues," No Turning Back–Live, Nashville, Tenn.: Lamb & Lion LL-1063, 1982. 12-inch 33 1/3 rpm LP album (2-record set). Archived in the Library
List_of_songs_about_Oklahoma
Retrieved April 16, 2025. Pucci, Douglas (April 23, 2025). "Monday Ratings: LL Cool J Guest Spot Boosts 'NCIS 'on CBS to its Most-Watched Telecast Since
List of The Neighborhood episodes
List_of_The_Neighborhood_episodes
American businessman and educator (1853–1925)
Scarecrow Press, p. 89. ISBN 9780810832879 L.L. Nunn timeline from Fort Lewis College Foundation, Center of Southwest Studies L.L. Nunn papers from Cornell
L._L._Nunn
Kiso H. Kosai, K. Furukawa · 5.0 km (3.1 mi) MPC · JPL 6819 McGarvey 1983 LL McGarvey June 14, 1983 Palomar Smrekar, S. · 4.7 km (2.9 mi) MPC · JPL 6820
List of minor planets: 6001–7000
List_of_minor_planets:_6001–7000
Ranking of recorded music
"Game Over (Flip)" Lil' Flip 66 "One Thing" Finger Eleven 67 "Headsprung" LL Cool J 68 "Damn!" YoungBloodZ featuring Lil Jon 69 "Baby Boy" Beyoncé featuring
Billboard Year-End Hot 100 singles of 2004
Billboard_Year-End_Hot_100_singles_of_2004
American lawyer
immigrants. He graduated from Harvard University in 1934 and attained his LL.B. degree from Harvard Law School in 1937. Treuhaft worked for labor union
Robert_Treuhaft
K – "Move This" Gwar – "The Road Behind" Sir Mix-a-Lot – "Baby Got Back" LL Cool J – "Big Ole Butt" Wreckx-n-Effect – "Rump Shaker" Sir Mix-a-Lot – "Baby
List of Beavis and Butt-Head episodes
List_of_Beavis_and_Butt-Head_episodes
American military drama/police procedural television series (2009–2023)
Created by Shane Brennan, the series starred Chris O'Donnell, Daniela Ruah, and LL Cool J with an ensemble cast, as it follows the exploits of the LA-based Office
NCIS:_Los_Angeles
American reality competition show
Retrieved April 16, 2025. Pucci, Douglas (April 23, 2025). "Monday Ratings: LL Cool J Guest Spot Boosts NCIS on CBS to its Most-Watched Telecast Since Season
Extracted_(TV_series)
43818 1992 ET32 — March 2, 1992 La Silla UESAC 3:2 11 km MPC · JPL 43819 1992 LL — June 3, 1992 Palomar G. J. Leonard · 2.5 km MPC · JPL 43820 1992 PP1 —
List of minor planets: 43001–44000
List_of_minor_planets:_43001–44000
Amendment to the Colorado Constitution
2024). "Inaugural March for Life Attacks Colorado Abortion Policy and Prop 89". coloradotimesrecorder.com. Colorado Times Recorder. Retrieved June 13, 2024
2024_Colorado_Amendment_79
President of the United States from 1861 to 1865
77–81, 87. Kent 2022, pp. 121–122. Donald 1996, p. 55. "Abraham Lincoln, LL. D." The New York Times. June 27, 1861. White 2009, p. 59. Foner 2010, pp
Abraham_Lincoln
1998 (1998-10-24) 607 15.87 Convicted murder and robber Dirk Morgan (Lindsey "LL" Ginter) escapes from prison seeking retribution against those responsible
List of Walker, Texas Ranger episodes
List_of_Walker,_Texas_Ranger_episodes
Aesthetic assessment of physical traits
PMC 2965103. PMID 21048972. DeBruine LM, Jones BC, Crawford JR, Welling LL, Little AC (August 2010). "The health of a nation predicts their mate preferences:
Physical_attractiveness
The Value of Lost Load (VoLL) is the estimated amount that customers receiving electricity with firm contracts would be willing to pay to avoid a disruption
Value_of_lost_load
(6): 613. Bibcode:1939PhRv...56..613A. doi:10.1103/PhysRev.56.613. Lucas, L.L.; Unterweger, M.P. (2000-07-01). "Comprehensive review and critical evaluation
Hydrogen isotope biogeochemistry
Hydrogen_isotope_biogeochemistry
Vöslau / Vienna area, five Luftwaffe Ju 52/3m ("G6+KH", "1Z+CL", "1Z+KK", "1Z+LL, and "1Z+JK") crashed at Leithagebirge, Austria, killing 31. The aircraft
List of accidents and incidents involving the Junkers Ju 52
List_of_accidents_and_incidents_involving_the_Junkers_Ju_52
Central nervous system stimulant
Westfall TC (2010). "Miscellaneous Sympathomimetic Agonists". In Brunton LL, Chabner BA, Knollmann BC (eds.). Goodman & Gilman's Pharmacological Basis
Amphetamine
August 10, 1998 Mobile, Alabama, United States 1971 Nominated jointly with St.Ll.Miller the only time by S.F.Gomes da Costa from Lisbon Ralph Franz Hirschmann
List of nominees for the Nobel Prize in Chemistry
List_of_nominees_for_the_Nobel_Prize_in_Chemistry
US television program
his father Danny Bible is a cold-blooded serial killer in hiding. 169 3 "He`ll Kill Me Next" January 28, 2026 (2026-01-28) Domeneka fears her boyfriend`s
Evil_Lives_Here
Non-pathological explanation of mental function variations
Services Review. 118 105456. doi:10.1016/j.childyouth.2020.105456. Allen LL, Mellon LS, Syed N, Johnson JF, Bernal AJ (March 25, 2024). "Neurodiversity-Affirming
Neurodiversity
Scottish football manager (born 1941)
leaving for Barcelona, alongside Jim Leighton from Aberdeen; but the 1988–89 season was a disappointment for them, finishing 11th in the league and losing
Alex_Ferguson
East Asian ethnic group
1093/molbev/msae122. PMC 11232699. PMID 38885310. Du, R; Xiao, C; Cavalli-Sforza, LL (1997). "Genetic distances between Chinese populations calculated on gene
Han_Chinese
dire living conditions elevating risks during pregnancy." It notes that "[a]ll these violations have increased miscarriages among pregnant women, preterm
Palestinian genocide allegations
Palestinian_genocide_allegations
Historical timeline
honoring pioneers and movements. Hip-hop musicians honored include Eazy-E, LL Cool J, The Notorious B.I.G., 2Pac, and Public Enemy. All of the shows have
History_of_VH1
Mexico (Chiapas) Porter, C.A.; Beasley, N.E.; Ordóñez-Garcia, N.; Lindsey, L.L.; Rogers, D.S.; Lewis-Rogers, N.; Sites, J.W. Jr.; Bradley, R.D (2017). "A
List of mammals described in the 21st century
List_of_mammals_described_in_the_21st_century
Singles recorded by Canadian rapper
2014. Retrieved May 19, 2014. Baker, Soren (December 23, 2013). "Mike WiLL Made-It '#MikeWiLLBeenTrill' Cover Art, Tracklist, Download & Mixtape Stream"
Drake_singles_discography
KK60 — May 25, 2000 Anderson Mesa LONEOS EUP 7.2 km MPC · JPL 162472 2000 LL — June 1, 2000 Socorro LINEAR AMO 510 m MPC · JPL 162473 2000 LA16 — June
List of minor planets: 162001–163000
List_of_minor_planets:_162001–163000
Tennis tournament
receive $5,000,000, a 38.89% increase over the previous year's payout, while runners-up will take home $2,500,000, also up by 38.89%. First-round losers in
2025_US_Open_(tennis)
192629 1999 KM11 — May 18, 1999 Socorro LINEAR · 1.8 km MPC · JPL 192630 1999 LL — June 5, 1999 Woomera F. B. Zoltowski · 2.2 km MPC · JPL 192631 1999 LG29
List of minor planets: 192001–193000
List_of_minor_planets:_192001–193000
Natural satellite orbiting Earth
reproducing the existence and apparently long duration of the lunar dynamo. Hood, L.L.; Huang, Z. (1991). "Formation of magnetic anomalies antipodal to lunar impact
Moon
Erectile female sexual organ
plays a pleasurable and central role in female sexuality and its joys", "[a]ll these favorable attributes, however, emerge just as clearly and just as easily
Clitoris
1997 KJ2 — May 29, 1997 Kitt Peak Spacewatch · 2.8 km MPC · JPL 52572 1997 LL — June 3, 1997 Xinglong SCAP · 3.5 km MPC · JPL 52573 1997 LM12 — June 7
List of minor planets: 52001–53000
List_of_minor_planets:_52001–53000
Palomar C. P. de Saint-Aignan · 11 km (6.8 mi) MPC · JPL 8711 Lukeasher 1994 LL Lukeasher June 5, 1994 Catalina Station C. W. Hergenrother · 14 km (8.7 mi)
List of minor planets: 8001–9000
List_of_minor_planets:_8001–9000
President of the United States from 1945 to 1953
attended business college, from 1923 to 1925 he took night courses toward an LL.B. at the Kansas City Law School (now the University of Missouri–Kansas City
Harry_S._Truman
KK120 — May 31, 2006 Kitt Peak Spacewatch ADE 3.1 km MPC · JPL 207546 2006 LL — June 1, 2006 Mount Lemmon Mount Lemmon Survey NYS 1.4 km MPC · JPL 207547
List of minor planets: 207001–208000
List_of_minor_planets:_207001–208000
Tennis championship
Kalinskaya (53) → replaced by Tamara Korpatsch (LL) § Danka Kovinić (65) → replaced by Nao Hibino (LL) † – not included on entry list ‡ – withdrew from
2023 Wimbledon Championships – Women's singles
2023_Wimbledon_Championships_–_Women's_singles
Island home of Greek mythological hero Odysseus
"Concerning Homeric Ithaki: Asteris". Odusseia (95). 1999. "kefa-ll-ines Kefa-ll-inia Kefa-ll-onia". Odusseia (70–2). 2000. Ekthesi Synoptiki peri Omerikis
Homer's_Ithaca
2024 American TV series or program
Retrieved April 16, 2025. Pucci, Douglas (April 23, 2025). "Monday Ratings: LL Cool J Guest Spot Boosts 'NCIS 'on CBS to its Most-Watched Telecast Since
Poppa's_House
Type of progressive dementia
Hershey & Coleman-Jackson 2019, pp. 316–317. Abdelnour C, Gonzalez MC, Gibson LL, Poston KL, et al. (June 2023). "Dementia with Lewy Bodies Drug Therapies
Dementia_with_Lewy_bodies
1989 crime in New York City
crimes. According to a later statement by District Attorney Nancy Ryan, "[a]ll five implicated themselves in a number of the crimes which had occurred in
Central_Park_jogger_case
American politician (born 1964)
that she was shown to have interviewed claimed to have never met her. Guests LL Cool J and Toby Keith stated that footage shown on the segment was actually
Sarah_Palin
Ballot measure in Colorado regarding hunting
EE 113 114 2022 125 126 FF 2023 HH II 2024 79 80 I J 127 128 129 131 2025 LL MM Colorado Springs Local elections 2019 Mayoral elections 1995 1997 sp 1999
2024_Colorado_Proposition_127
American actress (born 1941)
"Today's famous birthdays list for January 14, 2022 includes celebrities LL Cool J, Jason Bateman". Cleveland.com. January 14, 2022. Archived from the
Faye_Dunaway
Ranking of recorded music
featuring Lady Saw 72 "Caramel" City High featuring Eve 73 "Luv U Better" LL Cool J 74 "Gimme the Light" Sean Paul 75 "Gone" NSYNC 76 "Livin' It Up" Ja
Billboard Year-End Hot 100 singles of 2002
Billboard_Year-End_Hot_100_singles_of_2002
Prime Minister of Japan since 2025
2022). Japan Decides 2021: The Japanese General Election. Springer Nature. p. 89. ISBN 978-3-031-11324-6. Archived from the original on 7 October 2025. Dobson
Sanae_Takaichi
X chromosome monosomy
ISSN 1759-5037. PMID 31213699. Lin AE, Prakash SK, Andersen NH, Viuff MH, Levitsky LL, Rivera-Davila M, et al. (October 2019). "Recognition and management of adults
Turner_syndrome
Mid-size crossover SUV
Century Daihatsu (Perodua) Hino (25%) through Archion Lexus Former Scion WiLL Toyopet Leahead1 Ranz2 Subsidiaries Asia- Pacific Australia Altona Plant China
Toyota_Grand_Highlander
American rapper and actor (born 1975)
interest in working with rappers other than G-Unit, such as Lil' Scrappy of BME, LL Cool J of Def Jam, Mase of Bad Boy, and Freeway of Roc-A-Fella, and recorded
50_Cent
Light-duty model in the Toyota Land Cruiser range
Century Daihatsu (Perodua) Hino (25%) through Archion Lexus Former Scion WiLL Toyopet Leahead1 Ranz2 Subsidiaries Asia- Pacific Australia Altona Plant China
Toyota_Land_Cruiser_Prado
Ranking of recorded music
All three singles from the 1995 album Mr. Smith by LL Cool J (pictured) were featured on the Year-End chart, with two—"Hey Lover" and "Loungin"—appearing
Billboard Year-End Hot 100 singles of 1996
Billboard_Year-End_Hot_100_singles_of_1996
Simulcast On MTV". Deadline Hollywood. Kirsten Chuba (August 14, 2025). "LL Cool J Set to Host 2025 MTV VMAs". The Hollywood Reporter. Ethan Millman (September
2025_in_American_television
Handheld game console
more comfortable option for extended play. The Nintendo 3DS XL (Nintendo 3DS LL in Japan) was released on July 28, 2012, in Japan, priced at ¥18,900, and
Nintendo_3DS
Daleks "Episode 1"† Derek Martinus David Whitaker 20 May 1967 (1967-05-20) LL 8.1 51 "Episode 2" 27 May 1967 (1967-05-27) 7.5 51 "Episode 3"† 3 June 1967 (1967-06-03)
List of Doctor Who episodes (1963–1989)
List_of_Doctor_Who_episodes_(1963–1989)
2016 film by Nitesh Tiwari
finest." Maitland McDonagh wrote for Film Journal International that "[a]ll four actresses playing Geeta and Babita are strikingly good, and Khan stands
Dangal_(2016_film)
For Comfort While Eating Spicy Wings" February 16, 2023 (2023-02-16) 283 5 "LL Cool J Needs Some Milk While Eating Spicy Wings" February 24, 2023 (2023-02-24)
List_of_Hot_Ones_episodes
LL 89
LL 89
Surname or Lastname
South German (Düll)
South German (Düll) : nickname for a stubborn man.German (Düll) : variant of Dill 5.English : unexplained.
Surname or Lastname
English
English : variant of Selman.German (Sillmann) : possibly a variant of Sieler, or a topographic name for someone living on a ridge, from Low German süll, sill ‘sill’, ‘threshold’, ‘ramp’.
Surname or Lastname
Jewish (Ashkenazic)
Jewish (Ashkenazic) : ornamental name from German Balsam or Yiddish balzam ‘balm’, ‘balsam’.German : occupational name for a seller of spices and perfumes, from Latin balsamum ‘balsam’, ‘aromatic resin’.German : variant of Balsel (see Baltzell).English : habitational name from Balsham in Cambridgeshire, named with an Old English personal name, Bæll(i), + hÄm ‘homestead’, ‘village’, or Balstone in Devon.
Surname or Lastname
English
English : habitational name from any of various places, for example in Cumbria, Derbyshire, County Durham, Warwickshire, and Worcestershire, named Blackwell, from Old English blæc ‘black’, ‘dark’ + wæll(a), well(a) ‘spring’, ‘stream’.
Male
Icelandic
Icelandic form of Greek Paulos, PÃLL means "small."
Surname or Lastname
Swedish
Swedish : ornamental name formed with häll ‘rock’, ‘stone’ + the adjectival suffix -én, a derivative of Latin -enius.English : variant of Ellen 1 (with inorganic initial H-).English : variant of Hillian.Irish (west Cork) : variant of Heelan.
Surname or Lastname
English
English : variant of Sale 1.English : from a short form of a personal name beginning with Sal-, for example Salomon.Swedish (Säll) : nickname from säll ‘happy’, ‘fortunate’, probably a soldier’s name.African : unexplained.
Surname or Lastname
English
English : from an Old English personal name, Lulla.German (Lüll) : from a short form of any of the Germanic personal names formed with liut- ‘people’ as the first element.Catalan (also Llull) : from the personal name Lullus, probably of Germanic origin.
Surname or Lastname
German (Stallmann)
German (Stallmann) : variant of Staller.German : topographic name for someone who lived in a muddy place, from the dialect word stal.English : habitational name from Stalmine in Lancashire, named probably with Old English stæll ‘creek’, ‘pool’ + Old Norse mynni ‘mouth’.English : possibly an occupational name for a stockman, from Middle English stall ‘stall’ + man ‘man’, or a topographic name for someone who lived by some cattle stalls.
Surname or Lastname
English and Scottish
English and Scottish : variant spelling of Hallam.Norwegian : habitational name from any of three farmsteads so named in southeastern Norway, from either the dative plural of Old Norse hǫll ‘slope’ or Old Norse Hallheimr, a compound of hallr ‘slope’ + heimr ‘farmstead’.
Surname or Lastname
English
English : nickname from Middle English trull ‘slattern’, ‘prostitute’.German : nickname for a street entertainer or a cheat, from a noun derivative of Middle High German trüllen ‘to juggle’, also ‘to cheat’.German (also Trüll) : from a short form of the female personal name Gertrud (see Trude).
Surname or Lastname
English (Lancashire)
English (Lancashire) : habitational name from a place near Kirkham, named with Middle English thrall ‘serf’ (Old Norse þrǽll) + fall ‘clearing’, ‘place where the trees have been felled’.
Surname or Lastname
English
English : habitational name from Tonacliffe in Lancashire, recorded in 1246 as Tunwal(e)clif, from Old English tūn ‘enclosure’, ‘settlement’ + wæll(a) ‘spring’, ‘stream’ + clif ‘bank’, ‘slope’.
Surname or Lastname
English
English : unexplained.Possibly a shortened form of any of several German compound surnames formed with Full- or Füll-.
Surname or Lastname
Dutch
Dutch : variant spelling of Pol.English (Norfolk) : variant of Paul or Pool.German (also Pöll) : from a short form of a personal name composed with Old High German bald ‘bold’, ‘brave’.North German : variant of Pohl 2.South German form of Boll.
Surname or Lastname
English (Cumbria)
English (Cumbria) : habitational name from Threlkeld in Cumbria, so named from Old Norse þrǽll ‘thrall’, ‘serf’ + kelda ‘spring’.
Surname or Lastname
English
English : of uncertain origin, possibly from an unrecorded late survival of the Old English personal name Tula.South German (Tüll) : from a nickname for someone who was patient, from Middle High German dult ‘patience’; or from a personal name formed with the same word; or from Middle High German tult, dult ‘fair’, ‘festival’ (Bavarian Dult).South German : nickname for a stubborn man, Tull.Altered spelling of German Toll.
Female
Icelandic
Feminine form of Icelandic Páll, PÃLA means "small."
Surname or Lastname
English
English : status name from Old English þrǣl ‘thrall’, ‘serf’ (from Old Norse þræll).
Male
Icelandic
Icelandic form of Norwegian NjÃ¥l, NJÃLL means "champion."
LL 89
LL 89
Girl/Female
Australian, Biblical, Kurdish
Bush
Boy/Male
Celtic American Gaelic English Scottish Irish
Slender.
Boy/Male
Hindu
Simple of Joy, Prosperous
Girl/Female
Tamil
Hanshika | ஹநà¯à®·à¯€à®•à®¾Â
Swan or beautiful lady
Boy/Male
Tamil
Strong, Formidable
Boy/Male
Australian, Greek
People's Victory
Boy/Male
African
Strong.
Girl/Female
Indian, Tamil
Queen of Waves
Boy/Male
Hindu, Indian
Lord Indra
Boy/Male
Tamil
Monkey, Sun
LL 89
LL 89
LL 89
LL 89
LL 89
n.
One of the adherents of Charles L. or Charles LL.; -- so called by the opposite party.
a.
Applied to certain consonants having a "liquid" or softened sound; e.g., in French, l or ll and gn (like the lli in million and ni in minion); in Italian, gl and gn; in Spanish, ll and ; in Portuguese, lh and nh.
n.
A rare metallic element of the boron-aluminium group, found in gadolinite and other rare minerals, and extracted as a dark gray powder. Symbol Y. Atomic weight, 89.
superl.
Made with a somewhat elevated position of some certain part of the tongue, in relation to the palate; midway between the high and the low; -- said of certain vowel sounds; as, a (ale), / (/ll), / (/ld). See Guide to Pronunciation, // 10, 11.
n.
See Karyoplasma. L () L is the twelfth letter of the English alphabet, and a vocal consonant. It is usually called a semivowel or liquid. Its form and value are from the Greek, through the Latin, the form of the Greek letter being from the Phoenician, and the ultimate origin prob. Egyptian. Etymologically, it is most closely related to r and u; as in pilgrim, peregrine, couch (fr. collocare), aubura (fr. LL. alburnus).
superl.
Made, as a vowel, with a less tense, and more open and relaxed, condition of the mouth organs; -- opposed to primary as used by Mr. Bell, and to narrow as used by Mr. Sweet. The effect, as explained by Mr. Bell, is due to the relaxation or tension of the pharynx; as explained by Mr. Sweet and others, it is due to the action of the tongue. The wide of / (/ve) is / (/ll); of a (ate) is / (/nd), etc. See Guide to Pronunciation, / 13-15.